Protein Info for EX31_RS10410 in Rahnella sp. WP5

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00106: adh_short" amino acids 4 to 184 (181 residues), 84.6 bits, see alignment E=9.6e-28 PF08659: KR" amino acids 5 to 102 (98 residues), 23.3 bits, see alignment E=8.3e-09 PF13561: adh_short_C2" amino acids 12 to 189 (178 residues), 61.8 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: None (inferred from 64% identity to kva:Kvar_2575)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>EX31_RS10410 SDR family NAD(P)-dependent oxidoreductase (Rahnella sp. WP5)
MKTFLSIGSGPGIGIATAVRFAREGFRIVLTSRNKNYVSEQVTVLRAAGYQAEGRFADAS
DVRGIAELIRSVESETGAIDVLHFNSAALHDGTLETQSVDRFIEDLTINIGAAFVAVKEA
SLSMAERSEGTILLTGGIFATHPNADYLSLSVGKAGLRNLVYGLFDNLKEKNIHIATVTV
GTLVAAGSDESSDIAQTFWDLHVQSSNEWTAEKQYPSA