Protein Info for EX31_RS10285 in Rahnella sp. WP5

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 189 to 216 (28 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 273 (184 residues), 57 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 40% identical to SUGB_MYCTU: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2683)

MetaCyc: 40% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>EX31_RS10285 carbohydrate ABC transporter permease (Rahnella sp. WP5)
MKLNRQQQKLAQRSLIFAGSAFACLICLFPFYYAIITSLRSGANLFTVIWLPDEMNWGNY
VTALMDNGIARSLFNSAVVATLTVGLCLLVSITAAFALSRIRFTGRKYLLFTILCVSMFP
QVAVLSGMFELVRFMGLYDSLGALVLSYTTFSLPFTIWVLTTFMKAIPVELEEAAIVDGA
STWTIISRIFVPIMGPSLVTTGLLAFIGAWNEFMFALTFVISGDKRTVPVAISMLQGSSQ
FELPWGAIMASSVIVTLPIVVLVLIFQRRIVSGLTNGAVKG