Protein Info for EX31_RS10185 in Rahnella sp. WP5

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 204 to 232 (29 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details amino acids 398 to 415 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 205 to 355 (151 residues), 49.4 bits, see alignment E=2.2e-17

Best Hits

KEGG orthology group: K02847, O-antigen ligase [EC: 6.-.-.-] (inferred from 99% identity to rah:Rahaq_2664)

Predicted SEED Role

"O-antigen ligase" in subsystem LOS core oligosaccharide biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.-.-.-

Use Curated BLAST to search for 6.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>EX31_RS10185 O-antigen ligase family protein (Rahnella sp. WP5)
MNSKSATAPLKIIVNASVIALCISLSLSMFITGWPQKIFYVVSYVSFFTTLYAIYKKDIS
FKNEHFYLVMFFSLFFLAAVRFVWAMMLKHNGIDPSPTSAGIINNYLVGSKRILLGAFVI
LCLSVYGSLTTQKTIFLSKVIIVVGLIVTLGFGLHEHFYTVNDRIKLTTDASSMSSYMII
FIYAAYLGLSRLENHRYSKCLDLGAFILTFILLYLCGTRITILALIFVKLTFIFLEYKID
LRKNWQMAGLVVLAIVTILGITGHRWAQGINDIQKYDVQSSTSLGARVAIWESGIYLLHH
HIGFTTPDERTTLARAFIKTHHPENTEGYTNVQYNMHNEFLEVTTLQGLLGTFSLLLPYL
VLIYGWVRKVNIKGMVLPFIALFVTGLTDSVILYDQTATLFVISLAVCCIGTRKSAE