Protein Info for EX31_RS10180 in Rahnella sp. WP5

Annotation: type II 3-dehydroquinate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01220: DHquinase_II
  • amino acids 5 to 140 (136 residues), 201.3 bits, E=2.5e-64
• TIGR01088: 3-dehydroquinate dehydratase, type II
  • amino acids 5 to 141 (137 residues), 192.7 bits, E=1.1e-61

Best Hits

Swiss-Prot: 55% identical to 3DHQ1_NECH7: Catabolic 3-dehydroquinase 1 (qutE1) from Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 99% identity to rah:Rahaq_2663)

MetaCyc: 53% identical to periplasmic dehydroquinate dehydratase (Gluconobacter oxydans)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

• superpathway of chorismate metabolism (52/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• gallate biosynthesis (2/3 steps found)
• quinate degradation I (2/3 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• quinate degradation II (1/3 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (8/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (8/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.10

Use Curated BLAST to search for 4.2.1.10

Protein Sequence (146 amino acids)

>EX31_RS10180 type II 3-dehydroquinate dehydratase (Rahnella sp. WP5)
MNYNIAVFNGPNLNLLGTREPETYGHDTLATIEKLCHQTGENCGAKIEFFQTNHEGDLID
RIQACRGKVDAIVLNAAAWTHTSVAIRDAVTAVSLPLYEVHITNVHKRDAFRHHSFLSDI
AVGVICGFGIQGYEYAIRQAVVNLNK