Protein Info for EX31_RS10135 in Rahnella sp. WP5

Annotation: ROK family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF12802: MarR_2" amino acids 2 to 49 (48 residues), 28.3 bits, see alignment 2.4e-10 PF13412: HTH_24" amino acids 4 to 47 (44 residues), 23.3 bits, see alignment 5.9e-09 PF00480: ROK" amino acids 85 to 368 (284 residues), 154.9 bits, see alignment E=5.4e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2653)

Predicted SEED Role

"Xylose-responsive transcription regulator, ROK family" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>EX31_RS10135 ROK family transcriptional regulator (Rahnella sp. WP5)
MLTTLQRQILGAVNAAGGLSRTELAQSSGMSKAAIGGVVREMIEAGFLHEAETVPGSGQG
RPSVRLVVHPDGAWFAGVSLLQNPAQMALINLHGEILSRVSFAADADPQQLAANIASALP
ALLEPHPEAAKKLVGLGVTLSGLIDEHQSTCVQSALLGWRDVPLARLISQATGMDVAIEN
DAKALAVSEKSFGQARDLSSFTLVSHGAGIGSAHFIAGQLHRGLHGGAGEIAHCTLELNG
SPCRCGKRGCLDTLASLNAIAEMAKAEGLDASTIGGLEQLAMQGQTAAIRILHRAGSALG
LAISHLIQINDPDLILIAHQDADFSGLFGTVVHQSVEANVLPGNAGKTPVRTFTLNDDTW
ARAAASIAAHRFLVGLKPV