Protein Info for EX31_RS10075 in Rahnella sp. WP5

Annotation: bifunctional acetaldehyde-CoA/alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 5 to 400 (396 residues), 90.9 bits, E=1.1e-29
• PF00465: Fe-ADH
  • amino acids 457 to 849 (393 residues), 379.8 bits, E=1.8e-117
• PF13685: Fe-ADH_2
  • amino acids 472 to 555 (84 residues), 32.5 bits, E=1.2e-11
  • amino acids 589 to 738 (150 residues), 36.3 bits, E=8.3e-13

Best Hits

Swiss-Prot: 90% identical to ADHE_ECO57: Aldehyde-alcohol dehydrogenase (adhE) from Escherichia coli O157:H7

KEGG orthology group: K04072, acetaldehyde dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.2.1.10] (inferred from 90% identity to ddc:Dd586_2144)

MetaCyc: 90% identical to fused acetaldehyde-CoA dehydrogenase and iron-dependent alcohol dehydrogenasealdehyde/alcohol dehydrogenase AdhE (Escherichia coli K-12 substr. MG1655)
Acetaldehyde dehydrogenase (acetylating). [EC: 1.2.1.10]; Alcohol dehydrogenase. [EC: 1.2.1.10, 1.1.1.1]; 1.1.1.1 [EC: 1.2.1.10, 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1); Acetaldehyde dehydrogenase (EC 1.2.1.10)" (EC 1.1.1.1, EC 1.2.1.10)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of anaerobic sucrose degradation (18/19 steps found)
• superpathway of N-acetylneuraminate degradation (20/22 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• superpathway of purine deoxyribonucleosides degradation (7/7 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
• ethanolamine utilization (5/5 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (3/3 steps found)
• 2-deoxy-D-ribose degradation I (3/3 steps found)
• ethanol degradation II (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• L-threonine degradation IV (2/2 steps found)
• ethanol degradation I (2/2 steps found)
• pyruvate fermentation to ethanol II (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-methionine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• 2-aminoethylphosphonate degradation I (1/3 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (1/3 steps found)
• sulfoacetaldehyde degradation IV (1/3 steps found)
• salidroside biosynthesis (1/4 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• catechol degradation I (meta-cleavage pathway) (1/5 steps found)
• phenylethanol biosynthesis (1/5 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• catechol degradation II (meta-cleavage pathway) (2/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• triethylamine degradation (1/6 steps found)
• toluene degradation I (aerobic) (via o-cresol) (1/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (1/7 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (1/8 steps found)
• p-cumate degradation (1/8 steps found)
• meta cleavage pathway of aromatic compounds (2/10 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• naphthalene degradation to acetyl-CoA (2/12 steps found)
• p-cymene degradation (1/11 steps found)
• toluene degradation IV (aerobic) (via catechol) (2/13 steps found)
• L-tryptophan degradation IX (1/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (1/12 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)
• mandelate degradation to acetyl-CoA (4/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (8/35 steps found)
• superpathway of aerobic toluene degradation (4/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (8/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Butanoate metabolism
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Pyruvate metabolism
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.2.1.10

Protein Sequence (889 amino acids)

>EX31_RS10075 bifunctional acetaldehyde-CoA/alcohol dehydrogenase (Rahnella sp. WP5)
MAVTNVAELNALVARVKKAQREYANFSQEQVDKIFAAAALAAADSRILLAKLAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILGQDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDEPSVELSNQ
LMHHPDLNLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASVLMSKTF
DNGVICASEQSIIVVDSAYNAVRERFASHGGYMLQGKELKAVSDIILKNGGLNAAIVGQP
AVKIAEMAGIKVPANTKVLIGEVTIVDESEPFAHEKLSPTLAMYRAKNFEDAVAKAEKLV
EMGGIGHTSCLYTDQDNQPERVNYFGNKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRFLFNNGYADQITSVLKGHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVLYEHPNTQFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKENLPASYKDGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLGAPGDRTAQKIQKLLTWLDEIKAELGIPTSIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQILMDTYYGREYSEDVAEEVAAPAPKAEKKTSKK