Protein Info for EX31_RS10045 in Rahnella sp. WP5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00005: ABC_tran" amino acids 52 to 203 (152 residues), 117.1 bits, see alignment E=1e-37 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 253 to 340 (88 residues), 94.8 bits, see alignment E=1.3e-31 PF08352: oligo_HPY" amino acids 255 to 322 (68 residues), 70.5 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 90% identical to OPPF_SALTY: Oligopeptide transport ATP-binding protein OppF (oppF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to rah:Rahaq_2636)

MetaCyc: 90% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppF (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>EX31_RS10045 ABC transporter ATP-binding protein (Rahnella sp. WP5)
MTDNTIMNSAAMNTHAPEKKVLLEVADLKVHFDIKDGKQWFWQPSKTLKAVDGVTLRLYE
GETLGVVGESGCGKSTFARALIGLVKATDGRVAWLGKDLLNMSDSEWRHTRSDIQMIFQD
PLASLNPRMTIGEIIAEPLKTYNPKMPRLEVKEKVKAMMLKVGLLPNLINRYPHEFSGGQ
CQRIGIARALILEPKLIICDEPVSALDVSIQAQVVNLLQQLQREMGLSLIFIAHDLAVVK
HISDRVLVMYLGHAVELGTYDEVYNNPQHPYTRALMSAVPVPDPDKERNKVIQLLEGELP
SPINPPSGCVFRTRCPIAGPECAITRPLLEGSFRHAVSCLKVDPL