Protein Info for EX31_RS09990 in Rahnella sp. WP5

Annotation: outer membrane protein OmpW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13505: OMP_b-brl" amino acids 10 to 210 (201 residues), 53.2 bits, see alignment E=8.7e-18 PF03922: OmpW" amino acids 22 to 210 (189 residues), 231.2 bits, see alignment E=2e-72 PF05736: OprF" amino acids 51 to 140 (90 residues), 33.2 bits, see alignment E=9.1e-12

Best Hits

Swiss-Prot: 61% identical to OMPW_ECOLI: Outer membrane protein W (ompW) from Escherichia coli (strain K12)

KEGG orthology group: K07275, outer membrane protein (inferred from 100% identity to rah:Rahaq_2624)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>EX31_RS09990 outer membrane protein OmpW (Rahnella sp. WP5)
MKAAYWALVAAAAFPAVSSAHQAGDVIFRVGTATVRPTEGSDNVLGLGSFNINNNTQMGL
TLGYMFTDNIGMELLAATPFQHKVGLQSTGTIAEVKQLPPSLMAQYYFGDRQDKLRPYLG
VGINYTTFYDADFNQTGRDAGLSDLSVKDSWGVATQAGLDYNLDDNWLINMSVWWMDIDT
EVKFKAGGEQQNINTRIDPWVFMFGAGYRF