Protein Info for EX31_RS09810 in Rahnella sp. WP5

Annotation: autoinducer-2 kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00370: FGGY_N" amino acids 2 to 246 (245 residues), 162.7 bits, see alignment E=1.2e-51 PF02782: FGGY_C" amino acids 286 to 454 (169 residues), 67.3 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 80% identical to LSRK_YERE8: Autoinducer-2 kinase (lsrK) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K11216, autoinducer 2 (AI-2) kinase [EC: 2.7.1.-] (inferred from 99% identity to rah:Rahaq_2588)

MetaCyc: 77% identical to autoinducer-2 kinase (Escherichia coli K-12 substr. MG1655)
RXN0-5461 [EC: 2.7.1.189]

Predicted SEED Role

"Autoinducer 2 (AI-2) kinase LsrK (EC 2.7.1.-)" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>EX31_RS09810 autoinducer-2 kinase (Rahnella sp. WP5)
MALDAGTGSIRAVIFNLEGEQIATGQAEWIHLAVPDVPGSMEFDLQKNWQLACQCIRQAL
QEAHLPASAIRAVAACSMREGIVLYDKSGEPVWACANVDARASREVSELKEIHDFEFERE
VYECSGQTLALSAMPRLLWLAHHRPDIYRQAATITMISDWLAYMLSGELAVDPSNAGTTG
MLDLTTRNWRPELLDMAGLRADILSPVAETGTRLGYVTASAADACGLKAGTLVGMGGGDA
QLGTLGLGLVRPGQTAVLGGTFWQQIVNLPEAVTDPEMNIRVNPHVIPGMAQAESISFFT
GLTMRWFRDAFCTEEKTMAQRLGVDAYSLLEDMAARVPVGAWGVTPVFSDAMHFKNWYHA
APSFINLSIDPEKCNKPVLFRALEENAAIVSACNLDMIARFSGVRARSLVFSGGGSKGKL
WCQILSDVTGVPVNVPVVKEATALGCAIAAGVAAGVYSSLADTGEALVRWEREYQPDVAN
HAKYLVQKANWQEVYADQLGLVDRQLTTSMWKAPGL