Protein Info for EX31_RS09800 in Rahnella sp. WP5

Annotation: autoinducer 2 ABC transporter ATP-binding protein LsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF00005: ABC_tran" amino acids 33 to 175 (143 residues), 97 bits, see alignment E=1.6e-31 amino acids 287 to 437 (151 residues), 72.9 bits, see alignment E=4.4e-24

Best Hits

Swiss-Prot: 68% identical to LSRA_YERE8: Autoinducer 2 import ATP-binding protein LsrA (lsrA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K10558, AI-2 transport system ATP-binding protein (inferred from 99% identity to rah:Rahaq_2586)

MetaCyc: 64% identical to Autoinducer-2 ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Autoinducer 2 (AI-2) ABC transport system, fused AI2 transporter subunits and ATP-binding component" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>EX31_RS09800 autoinducer 2 ABC transporter ATP-binding protein LsrA (Rahnella sp. WP5)
MQSSKQLSADLQTTNLLLQVSGVSKSFSGVAVLKDIDFSLQCGEVHALLGGNGAGKSTLM
KIIAGVEIADSGTLLLGGEPLLALSPAKAHQAGIYLVPQEPMLFPSLTVRENILFRLPAH
QAGEKKLQQTLADLGCNLPLGALAGTLEVADQQLVEILRGLMRDARLLILDEPTASLTPA
ESARLFTQVRHLTGQGVGVVFISHKLPEIRAIADRVSVMRDGKIALSGRLAELDNDALIR
AITPHSQDTALPAEQKLWLDLPGTRRNPAGGEPVLQVQNLTGEGFINISFSARAGEIVGL
AGVVGAGRTELAETLYGLRDARRGQVLLQQQDISGLTTLQRLKKGLVYLPEDRQASGLYL
DAPLSWNTTSLTFNRQGWWLNIKREAAVLERYHRALGIQYRDGSQTARTLSGGNQQKLLI
AKCLEAQPAVLIVDEPTRGVDVSARADIYQLLREVVQQNVAVILISSDLDEIEGLADRVF
VMHQGEMSGELQGSDINVSNIMHIAFGNHAKTPATGGTSC