Protein Info for EX31_RS09690 in Rahnella sp. WP5

Annotation: undecaprenyl-diphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 110 to 123 (14 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 147 to 147 (1 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details PF14378: PAP2_3" amino acids 10 to 163 (154 residues), 27.6 bits, see alignment E=2.4e-10 PF01569: PAP2" amino acids 71 to 167 (97 residues), 50.8 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 60% identical to YBJG_ECOLI: Putative undecaprenyl-diphosphatase YbjG (ybjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2564)

MetaCyc: 60% identical to undecaprenyl pyrophosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Undecaprenyl-diphosphatase. [EC: 3.6.1.27]

Predicted SEED Role

"Putative permease"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>EX31_RS09690 undecaprenyl-diphosphate phosphatase (Rahnella sp. WP5)
MEQLNHLIFLWINATPDSPKALIQLATFLANDLIMIVPLLIIGLWLWGHQERIDKQREMI
SKTAIALLFAMTTAKTFSMLFPHARPFVEGFGYNFLHHSPDDSFPSDHGTVSFTFALAFL
FWHRIWSGALLMVTALSIAWSRVYLGVHWPLDMLGGFLVGMLGCLFAQLVWNLFGEPINA
LMCKVYRFGFAFPIKKGWVQH