Protein Info for EX31_RS09600 in Rahnella sp. WP5

Annotation: flagellar type III secretion system protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details PF01311: Bac_export_1" amino acids 14 to 246 (233 residues), 222.1 bits, see alignment E=3.9e-70 TIGR01400: flagellar biosynthetic protein FliR" amino acids 14 to 251 (238 residues), 241.6 bits, see alignment E=4.9e-76

Best Hits

Swiss-Prot: 66% identical to FLIR_SALTY: Flagellar biosynthetic protein FliR (fliR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to rah:Rahaq_2501)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>EX31_RS09600 flagellar type III secretion system protein FliR (Rahnella sp. WP5)
MVSFDSTQLAGWLSMYFWPLLRILALISTAPITSEKSVPNRVKLGLGMMITFLIAPSLPP
VDTPIFSTPALWLAMQQIMIGTALGITMQLAFAAIRMAGEIMGLQMGISFATFYDPSNRL
NTPLLAQFLNLLAVLLFLSFNAHLWLISLLADSFHTLPISHNPVNAEGFMAVAKAGSIVF
SGGMMLALPIVTLLLTLNMALGLLNRVTPQLSVFVIGFPLTLSIGILAISLMMPMLAPFS
EHLFSEILDKIVLIMNQLAAD