Protein Info for EX31_RS09585 in Rahnella sp. WP5

Annotation: flagellar biosynthetic protein FliO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 41 to 109 (69 residues), 74.1 bits, see alignment E=3.6e-25 PF04347: FliO" amino acids 53 to 139 (87 residues), 77.9 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 55% identical to MOPB_PECCC: Protein MopB (mopB) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 100% identity to rah:Rahaq_2498)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>EX31_RS09585 flagellar biosynthetic protein FliO (Rahnella sp. WP5)
MSQNAATDSPYISGPVNHATTQASPQAMPASSVLTQVSTVLGGILLLILFIGWVVKRAGF
APQSKNNKLLKVTASVQVGRSEKVVIVEVDNTWLVLGVTAQNITPLHTLSAPPVEQTPDS
GNPNHPPADFRQLMQKMLKRPGKQA