Protein Info for EX31_RS09535 in Rahnella sp. WP5

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 3 to 103 (101 residues), 87.4 bits, E=4.2e-29
• PF02049: FliE
  • amino acids 17 to 104 (88 residues), 95.2 bits, E=1.1e-31

Best Hits

Swiss-Prot: 69% identical to FLIE_YERE8: Flagellar hook-basal body complex protein FliE (fliE) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 100% identity to rah:Rahaq_2488)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (104 amino acids)

>EX31_RS09535 flagellar hook-basal body complex protein FliE (Rahnella sp. WP5)
MSIQGIESVLQQMQATAIQAGAAPKTDTASEAGFASELKAALGKISETQNNAKLESEKLE
MGVPGVSLNDVMVDLQKSSISLQLGVQVRNKLVAAYQDVMNMSV