Protein Info for EX31_RS09470 in Rahnella sp. WP5

Annotation: flagella biosynthesis regulatory protein FliT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF05400: FliT" amino acids 21 to 106 (86 residues), 68.8 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 52% identical to FLIT_YERE8: Flagellar protein FliT (fliT) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K02423, flagellar protein FliT (inferred from 100% identity to rah:Rahaq_2474)

Predicted SEED Role

"Flagellar biosynthesis protein FliT" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>EX31_RS09470 flagella biosynthesis regulatory protein FliT (Rahnella sp. WP5)
MDQHQYLVNEYQLILSLSEQMLRLAREEKWDELVELEVSYVKAVEATTRLPMSEQTSVMI
QNDVRRYLRIILDNENTIKTLLQARMNKLTELIGQSSRQQQVNTTYGKIDLRSIAFGDRQ