Protein Info for EX31_RS09445 in Rahnella sp. WP5

Annotation: flagella biosynthesis regulatory protein FliZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR03823: flagellar regulatory protein FliZ" amino acids 5 to 166 (162 residues), 295.6 bits, see alignment E=4.3e-93 PF02899: Phage_int_SAM_1" amino acids 89 to 166 (78 residues), 29.9 bits, see alignment E=2.8e-11

Best Hits

Swiss-Prot: 57% identical to FLIZ_SALTY: Protein FliZ (fliZ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02425, FliZ protein (inferred from 100% identity to rah:Rahaq_2469)

Predicted SEED Role

"Flagellar biosynthesis protein FliZ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>EX31_RS09445 flagella biosynthesis regulatory protein FliZ (Rahnella sp. WP5)
MPAGIKTRPLSRYLKDFKHSQTHCSQCAKELDRMALVFRGQIINKEAIAKMDQPIDDDVW
HNLSQELTALCRFCSEISCNSHSSYFDIMAFKQYLFEQTEMNHSTVREYVVRLRRLDEIL
SANNYPLDKLSGDSIHQRIINDLPVAGHDNYRIALRKYDQYLAWQKSA