Protein Info for EX31_RS09330 in Rahnella sp. WP5

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details PF00654: Voltage_CLC" amino acids 74 to 413 (340 residues), 251.4 bits, see alignment E=1.5e-78 PF00571: CBS" amino acids 514 to 562 (49 residues), 17.1 bits, see alignment 5.9e-07

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to rah:Rahaq_2444)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>EX31_RS09330 chloride channel protein (Rahnella sp. WP5)
MSLKAFNPDVLQKSDLINLLIAIPAGIIAALVTIAFRGAISGINGLMFTDGSDITKAFNE
YPKIVWPLITTAGGVIAGFILILALRYENKHGKMPDYLDVIDQRLPGIPVVSTVLRGLSS
LASIASGGSIGREGAMVQLSALSGSLLGRFSRFKGVHQSDIIAMAAAGGLAAVYHAPFAG
ALFVAEIAFGVTAVQRLIPLFISASVAVLTVRSLTDYAPLYLYSSASFSPSFGAIFTVLI
IGMATGILGPLFISSIDKVRQWMKPISHPALRLGLGGLGVGLVAMISPLVLGNGFEVIDL
ILNNGDLQTSLLVLLILKIVATAITIGSGAVGGLFTPSLLIGAAGGALVCTFLQWLGFDP
GPVGLYAAIGMSALLAATSHAPLMSIMMAFEMTLNSSLLFPLMLATAISYVVASRLKVGG
TYPVLTRHNARFAAKNAFEYSTVASLISPCSKMYVDASLSEVVSEGLKQRTRYVYVVDRE
ERFLGVVPTNVVAAGLIDGSVKSGSPIGPFIEQEFTTIFQQASYEQAWAMFSNSPLERLP
VLENAESRRLLGVITKASLLNKAKDFL