Protein Info for EX31_RS09280 in Rahnella sp. WP5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 49 to 74 (26 residues), see Phobius details amino acids 136 to 165 (30 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 17 to 287 (271 residues), 180.9 bits, see alignment E=4.4e-57 PF00005: ABC_tran" amino acids 349 to 498 (150 residues), 121.2 bits, see alignment E=5.4e-39

Best Hits

Swiss-Prot: 60% identical to YWJA_BACSU: Uncharacterized ABC transporter ATP-binding protein YwjA (ywjA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rah:Rahaq_2434)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>EX31_RS09280 ABC transporter ATP-binding protein (Rahnella sp. WP5)
MLRRFFSYYAPYKKLFFLDFGCAILAGLLELGFPMAIKTFIDKLLPAHDWVLIIGATVGL
LLIYLFNTALMAIVNYWGHALGVGIETDMRREAFSHLQKLSFRYYDNTKTGHIITHVTKD
LEEVGEVAHHGPEDVFIAVMTFIGAFILMATVHVQLALMTIIIVPAMTWMVSRYGAQMTE
TWRRLFGQVGNFNARIEESIGGIRVVKAFANEAHEQKLFASDNDNYRTTKLKAYQIMTAS
LTLSYLSTRLVQLIVMVAGTWYVINGQLTYGGFVGFLLLVEVFFRPVAKISSVLESYPKG
IAGFKRFTQLIDTAPDITDRPGAQVVSHLRGDIHYDNVVFGYTSVSKILNGITLSINAGE
TLAFVGPSGAGKTTLCSLLPRFYELDSGSITIDGIDIRDMTQTSLRHNIGIVQQDVFLFG
GTIRENIAYGKLDASEAEIRLAASRARLDDVIDALPLGMDTVIGERGVKLSGGQKQRLSI
ARIFLKNPPILILDEATSALDTATEQAIQQSLAELSEGRTTLVIAHRLATIQNADRIIVV
DKEGIVEQGTHESLLAHQGRYAQLHAAQFR