Protein Info for EX31_RS09205 in Rahnella sp. WP5

Annotation: siderophore-iron reductase FhuF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 74 to 92 (19 residues), see Phobius details TIGR03951: siderophore-iron reductase FhuF" amino acids 64 to 238 (175 residues), 143 bits, see alignment E=5.7e-46 PF06276: FhuF" amino acids 69 to 210 (142 residues), 55 bits, see alignment E=1.4e-18 PF11575: FhuF_C" amino acids 218 to 238 (21 residues), 22.8 bits, see alignment (E = 6.9e-09)

Best Hits

KEGG orthology group: K13255, ferric iron reductase protein FhuF (inferred from 99% identity to rah:Rahaq_2410)

Predicted SEED Role

"Ferric reductase (1.6.99.14)" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>EX31_RS09205 siderophore-iron reductase FhuF (Rahnella sp. WP5)
MMQTLLDSFRETPVSWVADTFKPMTPLVTNAVPMSLLTTAEGCASVLKRYLDANAADAAK
CDTRRARISMWSQWYFATLLPSWVIVSLRHGWQLPIAAENVYLCMQEEGLPAQIYLDGEG
EALTSAEPMARFDVMIEQQLRPVCEALAEFSGLKPGIYWSNAAIRVGWGVKQAELVNADI
SDGMRLMESRELRYGGKNPLFQPLRAEDPSDPDSPQYRKQCCLRYDLEDHAMCPSCPLLL
AERKSGKRRKTVAG