Protein Info for EX31_RS09160 in Rahnella sp. WP5

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 TIGR00229: PAS domain S-box protein" amino acids 4 to 129 (126 residues), 73.4 bits, see alignment E=1.9e-24 amino acids 167 to 267 (101 residues), 28 bits, see alignment E=2e-10 PF08448: PAS_4" amino acids 20 to 124 (105 residues), 33.6 bits, see alignment E=1.2e-11 PF00989: PAS" amino acids 20 to 118 (99 residues), 35.5 bits, see alignment E=2.6e-12 PF13426: PAS_9" amino acids 20 to 121 (102 residues), 54.7 bits, see alignment E=3.3e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 270 to 432 (163 residues), 143.2 bits, see alignment E=6.2e-46 PF00990: GGDEF" amino acids 273 to 430 (158 residues), 166.9 bits, see alignment E=9.9e-53 PF00563: EAL" amino acids 451 to 681 (231 residues), 268.3 bits, see alignment E=1.7e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2401)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>EX31_RS09160 EAL domain-containing protein (Rahnella sp. WP5)
MSEDSDVLYRLLVQRVEDYAIYMLTPDGHIANWNAGAQRAKGYTPEEVVGKHFSCFYTEE
DRQNGWPQRGLETARSTGRYESEGWRQRKDGSRFWAHIIIEALREAGEIIGFAKITRDVT
ERRETEKALLQAKELAESNSEQLSSLSHFLNTVIANIPSSVIVENAVSREILLVNRQAER
LLGIPRDKMLGKRPQDCMGIGLSTFINKQSDECLRAEGLHRSEQQLLTAIGDRTLQTTSS
VIRGHDPQTSYVMMIADDVTDQQAAHARIHHMAHHDNLTSLPNRILFSQRLSEALQRDSY
THSHTATLCLDLDNFKNVNDALGHQVGDELLRAIAKRLRMTLRDDDTLARIGGDEFAVVL
PGLKDISAAHQISKRLIESVRPPVIIDGHSLSVGLSIGIALAGSTENTPDQLLRCADMAL
YEAKRNGRNRYEDFRLEMDAAARKRRVVEMDLRDAITCNQLRLYYQPITDARHDAVMGYE
ALMRWHHPENGLIMPVDFIPIAEETGLIHSLGSFALHEACREAASWKGSQTVAVNLSPIQ
FKNSGLLSVVESALEASGLDPSRLEVEITESVLLDNTLGNISTLRKLKSLGVRIALDDFG
TGYSSLSYLRSFPFDKIKIDRSFINDMHDSREALAIIRAITGMSRSLDIQTTAEGVETDE
QFRRLKEEGCTLFQGYFFGRPQPSESRLTGFAPL