Protein Info for EX31_RS09150 in Rahnella sp. WP5

Annotation: PTS cellobiose/arbutin/salicin transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 109 to 135 (27 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 283 to 285 (3 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 392 to 415 (24 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details PF00367: PTS_EIIB" amino acids 11 to 43 (33 residues), 55.5 bits, see alignment (E = 2.9e-19) PF02378: PTS_EIIC" amino acids 116 to 399 (284 residues), 137.1 bits, see alignment E=7.6e-44

Best Hits

KEGG orthology group: K02752, PTS system, arbutin-, cellobiose-, and salicin-specific IIB component [EC: 2.7.1.69] K02753, PTS system, arbutin-, cellobiose-, and salicin-specific IIC component (inferred from 100% identity to rah:Rahaq_2399)

Predicted SEED Role

"PTS system, arbutin-, cellobiose-, and salicin-specific IIBC component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>EX31_RS09150 PTS cellobiose/arbutin/salicin transporter subunit IIBC (Rahnella sp. WP5)
MSKNFAAISQSIVDAIGGAQNVAAVTHCMTRLRFVLNDESVVDAATLKAITGVMGVVRNE
KQCQVIIGNNVSQAYAEVLKLLPEGFSASDDSAAPAKNKITLKRIGSGILDALIGTMSPL
IPAIIGGSMVKLLAMILDMTGVFDKGASTLVILNTIGDGAFFFLPVMVAASAAVKFKTNM
SLAIAIAGILVHPAFIDLMAKAAQGQKVEFIGISVTAVKYTYTVIPALCMTWLLSYVEKW
VDRITPVVTKNFLKPMLIMLIAAPIAIMLIGPLGIWIGTGISAVVYTVHSYLGWLSVAIM
GAAWPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSEIGANLSLGGSSLAVAWRTKNPEL
RQTALAAAASAIVAGISEPALYGVALRLKRPLIACLISGFICGGVAGLGGLASHSMASPG
LFTSVQFFDPSNPMSIVWVVGVMVLAVVISFFTTLLLGFEDIPVETVAPKNTAPESTASA
AFAVSQSAVK