Protein Info for EX31_RS08875 in Rahnella sp. WP5

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00163: phosphatidylserine decarboxylase
  • amino acids 49 to 284 (236 residues), 308.6 bits, E=1.2e-96
• PF02666: PS_Dcarbxylase
  • amino acids 63 to 284 (222 residues), 210 bits, E=1.4e-66

Best Hits

Swiss-Prot: 79% identical to PSD_YERPB: Phosphatidylserine decarboxylase proenzyme (psd) from Yersinia pseudotuberculosis serotype IB (strain PB1/+)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to rah:Rahaq_0418)

MetaCyc: 67% identical to phosphatidylserine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (325 amino acids)

>EX31_RS08875 phosphatidylserine decarboxylase (Rahnella sp. WP5)
MLDSIKIKLQYLLPKQGLTRLAGWGADKRAATLTHWVIKAFARFYNVDMKEAQNPDLKSY
ATFNEFFVRPLRDGARPVVSGLDMLCLPADGAVSQLGAITDGKLFQAKGHFYSLEALLAG
NYLLAEQFKDGQFATIYLAPRDYHRVHMPCDGVLREMIYVPGDLFSVNPLTAANVPNLFA
RNERVICVFDTEFGPMVQILVGATIVGSIETVWAGCVTPPREGIIKRWTYPAAGEEGAIA
LEKGQEMGRFKLGSTVINLFAAKQIRFMPNLSNGTVTRMGEPFAEALREAAPATTDAQAP
ATEVPVATETPAGVATAEPQVPKDY