Protein Info for EX31_RS08670 in Rahnella sp. WP5

Annotation: class 1 fructose-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 2 to 194 (193 residues), 286.8 bits, E=7.2e-90
• PF18913: FBPase_C
  • amino acids 199 to 327 (129 residues), 165.9 bits, E=3.7e-53

Best Hits

Swiss-Prot: 91% identical to F16PA_PHOLL: Fructose-1,6-bisphosphatase class 1 (fbp) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to rah:Rahaq_0459)

MetaCyc: 85% identical to fructose-1,6-bisphosphatase 1 (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
• superpathway of anaerobic sucrose degradation (18/19 steps found)
• superpathway of N-acetylneuraminate degradation (20/22 steps found)
• gluconeogenesis I (13/13 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Protein Sequence (334 amino acids)

>EX31_RS08670 class 1 fructose-bisphosphatase (Rahnella sp. WP5)
MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGLVDILGTSGAENVQGE
VQMKLDLYANEKLKAAMKARGEIAGIASEEEDEIVIFEGERAENAKYVILMDPLDGSSNI
DVNVSVGTIFSIYRRTTPLGQPVTEADFLQPGNRQVAAGYVVYGSSTMLVYTTGAGVHAF
TYDPSLGVFCLSHEKVCFPKKGNMYSINEGNYIKFPLGVKKYIKYCQEQDEATQRPYTSR
YIGSLVADFHRNLLKGGIYIYPSTASHPNGKLRLLYECNPMAFLAEQAGGKASDGKNRIL
DIIPQKLHERAPFFVGNSSMVEDAERFIAQFPDE