Protein Info for EX31_RS08545 in Rahnella sp. WP5

Annotation: transcription termination/antitermination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF08529: NusA_N" amino acids 4 to 123 (120 residues), 126.8 bits, see alignment E=8e-41 TIGR01953: transcription termination factor NusA" amino acids 4 to 348 (345 residues), 405.3 bits, see alignment E=1.9e-125 PF13184: KH_5" amino acids 230 to 297 (68 residues), 97.3 bits, see alignment E=6.7e-32 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 372 to 421 (50 residues), 75.8 bits, see alignment 2.1e-25 amino acids 448 to 496 (49 residues), 66 bits, see alignment 2.5e-22 PF14520: HHH_5" amino acids 377 to 419 (43 residues), 18.3 bits, see alignment 4e-07 amino acids 439 to 493 (55 residues), 41.8 bits, see alignment 1.8e-14

Best Hits

Swiss-Prot: 87% identical to NUSA_ECO57: Transcription termination/antitermination protein NusA (nusA) from Escherichia coli O157:H7

KEGG orthology group: K02600, N utilization substance protein A (inferred from 100% identity to rah:Rahaq_0485)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>EX31_RS08545 transcription termination/antitermination protein NusA (Rahnella sp. WP5)
MNKEILAVVEAVSNEKSLPREKIFEALEIALSTATKKKYEQEIEVRVSIDRKTGDFDTFR
RWVAVNEVTQPTREITLEAAQYEDPSIDLGGYIEDQIESVTFDRITTQTAKQVIVQKVRE
AERAMVVDQFREQQGEIVTGVVKKVNRDSIALDLGSNAEAVILREDMLPRENFRSGDRIR
GVLYDVRPEARGAQLFVSRSRNEMLIELFRIEVPEIGEELIEIKAAARDPGSRAKIAVKT
NDKRIDPVGACVGMRGARVQAVSSELGGERIDIILWDDNPAQFVINAMAPADVASIVVDE
DKCTMDIAVEASNLAQAIGRNGQNVRLASQLLKQHRGDDKWELNVMTADDLQAKHQAEAH
AAIDTFTKYLAIDEDFATVLVEEGFSTLEELAYVPVNELLEIDGLDEDTVDALRERAKEA
LTTLALAQEESLGDKKPADDLLNLAGLERSMAFKLAAQGVCTLEDLAEQGVDDLADIEGL
TDEQAGELIMAARNICWFGDNA