Protein Info for EX31_RS08495 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 39 to 373 (335 residues), 108 bits, see alignment E=5.7e-35 PF01061: ABC2_membrane" amino acids 216 to 348 (133 residues), 33.6 bits, see alignment E=2.9e-12

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 99% identity to rah:Rahaq_0495)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>EX31_RS08495 ABC transporter permease (Rahnella sp. WP5)
MRPVKAPRSERVKAAWRCFSRAFTRETRHAFRKPVIHWLCWIFPLLLFGLISSNFSEGTL
LDLPVSVVDNDHSPLSKTLIRKLDAGSHAHVQAFEGGLPEAEYRLRTAQDYALLYIPNDF
EADVLAGKQPSAVLYYNALFYGAGLYSTQDFSGLITELNTRYRSIIATEMGKTLPSLASV
DVSYGSLFNASGSYIYYQQFAATIHLLQLFTVTCMIYVMARSQALLSAPSFTLALLGKLA
PYTLCFTTLLMAEIAMLVGFFDARVSGNPLYMLLIGFFYVIAAQSLGLLLFTFTKTTITA
YTMMGIFVSIALTFSGMAVPVLSMPLPARIISGIEPLSYALAAMFDVFLREVSVRGILMV
CCILLVYPLLTSLLVRKRLYMRMKQQEPGQ