Protein Info for EX31_RS08465 in Rahnella sp. WP5

Annotation: GIY-YIG nuclease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 PF01541: GIY-YIG" amino acids 6 to 78 (73 residues), 50.1 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 67% identical to YPOTE_SERLI: UPF0213 protein in potE 3'region from Serratia liquefaciens

KEGG orthology group: K07461, putative endonuclease (inferred from 100% identity to rah:Rahaq_0501)

Predicted SEED Role

"FIG137864: putative endonuclease containing a URI domain" in subsystem CBSS-214092.1.peg.3450

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>EX31_RS08465 GIY-YIG nuclease family protein (Rahnella sp. WP5)
MPTAANWFLYMLRTPTGMLYTGITTDVQRRLGQHQSGKGAKSLRGKGELQLAFQCPAGDR
SLASKLEIKVKKLSKAQKELLVRNAPECLENYLGLAESGK