Protein Info for EX31_RS08380 in Rahnella sp. WP5

Annotation: HTH-type transcriptional regulator TreR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR02405: trehalose operon repressor" amino acids 6 to 316 (311 residues), 465.5 bits, see alignment E=4.4e-144 PF00356: LacI" amino acids 8 to 53 (46 residues), 65.7 bits, see alignment 3.7e-22 PF00532: Peripla_BP_1" amino acids 91 to 263 (173 residues), 56 bits, see alignment E=6.6e-19 PF13377: Peripla_BP_3" amino acids 170 to 311 (142 residues), 57.2 bits, see alignment E=3.4e-19

Best Hits

Swiss-Prot: 58% identical to TRER_ECOLI: HTH-type transcriptional regulator TreR (treR) from Escherichia coli (strain K12)

KEGG orthology group: K03485, LacI family transcriptional regulator, trehalose operon repressor (inferred from 100% identity to rah:Rahaq_0521)

Predicted SEED Role

"Trehalose operon transcriptional repressor" in subsystem Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>EX31_RS08380 HTH-type transcriptional regulator TreR (Rahnella sp. WP5)
MTQQNRLTINDIARLSGVGKSTVSRVLNNEGNVSPQTRERVLQVIEQQHFSPSKSARAMR
GFSDKIVAIIVSRLDSPSENLAVRAMLPLFYQQGYDPIVLESQFSAERVKEHLQVLKQRN
IDGIVLFGFTGLSAQMLTPWQDKMVVLARDMPGLSSVCYDDAGAVQLLMQKLLAQNIREI
GFIGVSPQDTTTGQRRSAAFRTFCKEHGLTPHIALGELTYQSGFDLIPQLLKNNIQAVVC
ASDTIAIGAQKYLQQQQIRGVQVCGIGNNPLLHFLFPESYSVELGYGAGGEAAAKQLLAQ
LSGSTTVRQLIIPGKLAF