Protein Info for EX31_RS08285 in Rahnella sp. WP5

Annotation: maltoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02264: LamB" amino acids 27 to 431 (405 residues), 438 bits, see alignment E=2.9e-135

Best Hits

Swiss-Prot: 80% identical to LAMB_SERP5: Maltoporin (lamB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02024, maltoporin (inferred from 100% identity to rah:Rahaq_0541)

MetaCyc: 74% identical to maltose outer membrane channel / phage lambda receptor protein (Escherichia coli K-12 substr. MG1655)
RXN0-1741; RXN0-1804

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>EX31_RS08285 maltoporin (Rahnella sp. WP5)
MITMRSSSLALAVAAGILSTQAMAVDFTGYARSGIGWTGSGGEQQCFKATGADSKYRLGN
ECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWESTDPAFREANVKGKNLIEWLP
GSTMWAGKRFYQRHDVHMIDFYYWDISGPGAGLEDIDLGFGKLSLAATRNTESGGSYGYI
ADQRNEVPTSNDVFDVRLAGLQTNPGGVLELGVDYGRANARDGYSLADDATKDGFLVTAE
HTQSIYNGYNKFVLQYAADSMTDPGQGAANGHSNGAAINNNGSMVRVLDHGAIDFNDTWS
LMYVAMYQDVDRDNNNGTTWYTVGVRPMYKWTPIMSTLLEVGYDNVKSQRTGDKNGQYKV
TLAQQWQAGDSIWSRPAIRVFATYANWDEKWGYDTDSGASNGLAMNDTSTTTYSRGNDDE
VTFGAQMEIWW