Protein Info for EX31_RS08215 in Rahnella sp. WP5

Annotation: G/U mismatch-specific DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF03167: UDG" amino acids 8 to 154 (147 residues), 74.9 bits, see alignment E=3.6e-25

Best Hits

Swiss-Prot: 75% identical to MUG_PECCP: G/U mismatch-specific DNA glycosylase (mug) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03649, TDG/mug DNA glycosylase family protein [EC: 3.2.2.-] (inferred from 99% identity to rah:Rahaq_0607)

MetaCyc: 63% identical to stationary phase mismatch/uracil DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-1922 [EC: 3.2.2.28]

Predicted SEED Role

"G:T/U mismatch-specific uracil/thymine DNA-glycosylase" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>EX31_RS08215 G/U mismatch-specific DNA glycosylase (Rahnella sp. WP5)
MITDIIARDLSVVFCGINPGLSTAHHGFHFANANNRFWKVIYQAGFTGRLLKPEEEQHLL
DTDCGITMLVERPTVEATELVRDELREGGAALTAKIEYYQPRALAVLGKQAFSKAFGISK
VNWGRQALKIGDTEVWVLPNPSGLNRATLDELVSAYRELFLSLENTA