Protein Info for EX31_RS08080 in Rahnella sp. WP5

Annotation: esterase YqiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF05728: UPF0227" amino acids 4 to 188 (185 residues), 235 bits, see alignment E=3.5e-74

Best Hits

Swiss-Prot: 78% identical to YQIA_ECOLI: Esterase YqiA (yqiA) from Escherichia coli (strain K12)

KEGG orthology group: K07000, (no description) (inferred from 100% identity to rah:Rahaq_0635)

Predicted SEED Role

"Putative esterase, FIGfam005057"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>EX31_RS08080 esterase YqiA (Rahnella sp. WP5)
MNTLLYLHGFNSSPNSAKATALKNWLAVNHPHIDMVIPQLPPYPAEAAEELESLVISNAG
KKLGIVGSSLGGYYATWLSQCFAVPAVVVNPAVKPYELLIDFLGQNENPYTGQQYVLESR
HVYDLKVMQVEPLESPDLLWLLQQTGDEILDYRQAVAYYTTCRQTVEPEGNHAFVGFERY
FSPIVDFLELAAD