Protein Info for EX31_RS08065 in Rahnella sp. WP5

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF02525: Flavodoxin_2" amino acids 3 to 188 (186 residues), 109.6 bits, see alignment E=8.4e-36

Best Hits

Swiss-Prot: 67% identical to MDAB_ECO57: Modulator of drug activity B (mdaB) from Escherichia coli O157:H7

KEGG orthology group: K03923, modulator of drug activity B (inferred from 100% identity to rah:Rahaq_0638)

MetaCyc: 67% identical to NADPH:quinone oxidoreductase MdaB (Escherichia coli K-12 substr. MG1655)
RXN0-271 [EC: 1.6.5.10]

Predicted SEED Role

"Modulator of drug activity B"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>EX31_RS08065 NAD(P)H-dependent oxidoreductase (Rahnella sp. WP5)
MSNILIINAGKTFAHSKGALNNSLTDVATGFLRDKGHDVRVTVLEDGYDAQTEIESYLWA
DAIIYQQPGWWMGMPWTLKKYIDEVFTEGHGKLYASDGRTRSDESKKYGSGGLLHGKCYM
LSVTWNAPLEAFEDKEQFFHGVGVDGVYMAQHKANQFIGLDTLPTFMCNDVIKQPDVEGD
FARYRAHLENVFGQA