Protein Info for EX31_RS07985 in Rahnella sp. WP5

Annotation: 2-dehydro-3-deoxyglucarate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR03239: 2-dehydro-3-deoxyglucarate aldolase" amino acids 8 to 255 (248 residues), 473.5 bits, see alignment E=7.7e-147 PF03328: HpcH_HpaI" amino acids 21 to 244 (224 residues), 195.2 bits, see alignment E=4.7e-62

Best Hits

Swiss-Prot: 79% identical to GARL_ECOHS: 5-keto-4-deoxy-D-glucarate aldolase (garL) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K01630, 2-dehydro-3-deoxyglucarate aldolase [EC: 4.1.2.20] (inferred from 100% identity to rah:Rahaq_0654)

MetaCyc: 79% identical to alpha-dehydro-beta-deoxy-D-glucarate aldolase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxyglucarate aldolase. [EC: 4.1.2.20]

Predicted SEED Role

"2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.1.2.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>EX31_RS07985 2-dehydro-3-deoxyglucarate aldolase (Rahnella sp. WP5)
MSNQMIPNRFRQDLLQGKTLIGCWSALSSPISTEVLGLAGFDWLLLDGEHAPNDVSTFVP
QLMALKGSRSAPVVRPQFNDPVVIKRLLDIGFYNFLVPFVETQEQAELAVASTRYPPAGI
RGVSVSHRSNMFGTVPDYFNSINDNIAVMVQIESQQGVDNLDAIAAVDGIDGIFVGPSDL
AAGMGHLGNAGHPDVQAAIRHIFARAKAHGKPSGILAPVEADARRYLEWGATFVAVGSDL
GVFRAGTQALCDRFTQ