Protein Info for EX31_RS07865 in Rahnella sp. WP5

Annotation: DUF3561 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 71 to 98 (28 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details PF12084: DUF3561" amino acids 33 to 125 (93 residues), 123 bits, see alignment E=3e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0679)

Predicted SEED Role

"Putative cytochrome oxidase subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>EX31_RS07865 DUF3561 family protein (Rahnella sp. WP5)
MQALFSRLVSRNRVDRTGEITPRTRVPIPETDSADTEDPSYSMQGGFIGFVFYWLAFAIP
FLVYGSNTLFFLLYTWPFFLALMPVSVLIGIAFSTFFGGGWFKTSLASAVCVIGMFWTVF
SFLSGW