Protein Info for EX31_RS07825 in Rahnella sp. WP5

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 46 to 326 (281 residues), 475.2 bits, see alignment E=7.8e-147 PF00140: Sigma70_r1_2" amino acids 54 to 85 (32 residues), 43.5 bits, see alignment 5.1e-15 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 89 to 315 (227 residues), 118.9 bits, see alignment E=1.7e-38 PF04542: Sigma70_r2" amino acids 92 to 161 (70 residues), 81 bits, see alignment E=8.9e-27 PF04539: Sigma70_r3" amino acids 172 to 246 (75 residues), 72.5 bits, see alignment E=4.8e-24 PF04545: Sigma70_r4" amino acids 260 to 313 (54 residues), 55.3 bits, see alignment 7.4e-19

Best Hits

Swiss-Prot: 93% identical to RPOS_SALTI: RNA polymerase sigma factor RpoS (rpoS) from Salmonella typhi

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 100% identity to rah:Rahaq_0687)

MetaCyc: 92% identical to RNA polymerase sigma factor RpoS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>EX31_RS07825 RNA polymerase sigma factor RpoS (Rahnella sp. WP5)
MSQNTLKVNELHDDVDFDENSAEAFDEKAIVEETADNDAEEELLSQTVSQRVLDATQLYL
GEIGYSPLLTAEEEVYFARRALRGDVPSRRRMIESNLRLVVKIARRYSNRGLALLDLIEE
GNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTA
RELAHKLDHEPSAEEIAEQLDKPVHDVSRMLRLNERITSVDTPLGGDSEKALLDILADEK
DNGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERV
RQIQVEGLRRLREILQGQGLSIEALFRE