Protein Info for EX31_RS07740 in Rahnella sp. WP5

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details PF01595: CNNM" amino acids 13 to 184 (172 residues), 185.3 bits, see alignment E=1.3e-58 PF00571: CBS" amino acids 278 to 326 (49 residues), 25.4 bits, see alignment 2.3e-09 PF03471: CorC_HlyC" amino acids 344 to 419 (76 residues), 68.9 bits, see alignment E=4.7e-23

Best Hits

Swiss-Prot: 80% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0700)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>EX31_RS07740 HlyC/CorC family transporter (Rahnella sp. WP5)
MEHVSTTTLIITLIIMVVVSAYFSASETGMMTLNRYRLRHLAKQGNRAARRVEKLLKRPD
QLISLVLIGNNLVNILASALATIVGIRLYGDAGVAIATGVLTFVVLLFAEVLPKTFAALN
PERIAFPSSILLRPLQTIMMPLVWILNSLSRLLMRMFGIKTTTSLSDAVSKEELRSIVNE
SRSNISRRNQDMLLSVLDLEKVSVDDIMVPRNEIVGIDINDDWKSIIRQLTHSPHGRIVL
YRDSLDDAIGMLRLREAYRLMTEKKEFTKENLLRAADEIYYIPEGTPLNIQLVKFQRNKK
KVGIVVDEYGDIQGLVTVEDILEEIVGDFTTSMSPTLAEEVTPQSDGSVLIEGSANVREL
NKAFNWHLPAEEARTINGMLLEVLEEIPTIGTNLRIEDYEVEILDVQDNMIKQVQVRPLQ
PLQSSVNQR