Protein Info for EX31_RS07735 in Rahnella sp. WP5

Annotation: inner membrane protein YpjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 20 (2 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 123 to 149 (27 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 39 to 260 (222 residues), 143.8 bits, see alignment E=3.1e-46

Best Hits

Swiss-Prot: 74% identical to YPJD_ECOLI: Inner membrane protein YpjD (ypjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0701)

Predicted SEED Role

"FIG001154: CcsA-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>EX31_RS07735 inner membrane protein YpjD (Rahnella sp. WP5)
MSVFALVAMLAYLLSLALIIPSIIRKNSAYRRLALISVVVALVCHAVALQQRIFDVSTGQ
NLSLVNIGSVVSLIIGTVMTIVASRNRGWFVLPIVYSFSLINLAFVTFLPGEFITHLEES
KGLLVHIGLALFSYATLMIAALYALQLAWLDYQLKNKRLTFTADMPPLMSIERKLFHITQ
IGVILLTLTLCTGLLYLNNLFSPENIDKAVLSILAWFVYIVLLWGHYHEGWRGRRVVWFS
MAGAILLTLAYFGSRLIQQIMVH