Protein Info for EX31_RS07695 in Rahnella sp. WP5

Annotation: phage tail tape measure protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 transmembrane" amino acids 276 to 358 (83 residues), see Phobius details amino acids 364 to 380 (17 residues), see Phobius details TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 136 to 212 (77 residues), 29.9 bits, see alignment E=1.5e-11 amino acids 214 to 290 (77 residues), 30.6 bits, see alignment E=8.8e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to rah:Rahaq_0710)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (543 amino acids)

>EX31_RS07695 phage tail tape measure protein (Rahnella sp. WP5)
MSNLEQLPHTLEKINQDLAAFRAETDKVRENLLMLPGKTLFSVVSEDITDASLQFEKSLF
APDSKTETQAFSGLKKAVASQSAEKLRQQRPMQMEQKGLEIAQQFKNRELKIGQLKNISS
SALSFAQPKLALAQTFLKPGADLEAGLAEVQSVLGLKNDDPHVAALRQQSLSMAASGHSP
AEVVARQQALAKGGMNADQVLEQTPAALNGATPAAQMAVTVKGDNLDGDITKLFATWDTI
RINLFDGQSAALRELTQTATSWLGTINTWITDNPMLVNSLLGLALGITGIVGGMGALGMV
IAPVLSGISMLMAGAGLLGTIFTGTGGMIAAAFTAIGLPLLPVIALIAGIGIAVVKLWEP
ISAFVGGVIDGFTAAMGPISGAFTPFRTALGWITDLFEPIHFTQDTLSGFTDIGKEVGEA
IAEIFVTLNKAVSQIGEVFSWAKKGWDSIFGDSEPAERPDISTPPLDGISPTGGALNLYQ
PAKSSVANNLTDNRATTVNLSFTATPETDHSQVRAWIEDSINQREWNNTNNLLSQYNNGG
IYS