Protein Info for EX31_RS07445 in Rahnella sp. WP5

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 108 (97 residues), 87 bits, see alignment E=5e-29 PF00528: BPD_transp_1" amino acids 48 to 215 (168 residues), 53.8 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 38% identical to GLNP_ECOL6: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2302)

MetaCyc: 38% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>EX31_RS07445 amino acid ABC transporter permease (Rahnella sp. WP5)
MLGLDDQVIAALPELGHGLLMTLTLTVLAALLSLVCGQIICFIQLRNAWLWRVTGRLYVS
LMRGTPAIVQLFVVFFTLPRLGLGGQPMLAAVLAIGLNSGAYVAEILRVNQSLVTRGQRE
AARTLGLNRWLTWWYVINPQVIRASLPMLVNEFTILLKTTPLASVVALTELTYAGQIVIA
RTYDATQVLLLVSAGYLLIALPLISAVRHLEAKRRMA