Protein Info for EX31_RS07375 in Rahnella sp. WP5

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 58 (17 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 143 to 159 (17 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 296 to 327 (32 residues), see Phobius details amino acids 347 to 379 (33 residues), see Phobius details PF00916: Sulfate_transp" amino acids 14 to 140 (127 residues), 75.7 bits, see alignment E=3.1e-25 amino acids 146 to 352 (207 residues), 112.9 bits, see alignment E=1.5e-36 PF01740: STAS" amino acids 390 to 474 (85 residues), 40 bits, see alignment E=2.8e-14

Best Hits

Swiss-Prot: 39% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2287)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>EX31_RS07375 SulP family inorganic anion transporter (Rahnella sp. WP5)
MFNPRGLKLSEMKNETLAGFVVAVSMIPEAVGFSLVAGLSPIVGLHTAFIIGLVTALFGG
KPGMVSGAAGSIVVVLMSLAAQHGMGYVLWATIFAGVIQILIGVFRLGKFIRLVPLPAVH
GFVNGLAIVIMLAQLHMIAGQGLLMYGLVLLAILVVVLFPKLTKIIPSSLAALIVVSAVA
IGFNLHTLRVGDLADISGALPHFSLPVAPFNVEMLKVVLPYAVVIALVGLIESLLTMTVL
DEMGHQKGNGNRESIAQGAGNTICGLFGCFAGCAMIGQSIINFTSGGRGRISGTVGAILL
ILFVVSLSGYIGLLPVAALAGIMLVVCYNTFEWSSLRRLRRMPKADVLVMLIVTVITIFT
DLAVAVISGVIISALVFAWQQARIRVREHKTKGDLAVYKLDGPLFFGSAATFAELFNPEN
DPQNVVLDFAGTRVMDSSGVEAIDKLTTRYLDAGKTIRLRHLSNDCVSLLKKAGPFCSHE
LDDPQYYVAEDNL