Protein Info for EX31_RS07325 in Rahnella sp. WP5

Annotation: lipoprotein localization protein LolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00548: outer membrane lipoprotein LolB" amino acids 7 to 205 (199 residues), 231.6 bits, see alignment E=3.3e-73 PF03550: LolB" amino acids 51 to 204 (154 residues), 145.8 bits, see alignment E=5.4e-47

Best Hits

Swiss-Prot: 69% identical to LOLB_YERPP: Outer-membrane lipoprotein LolB (lolB) from Yersinia pestis (strain Pestoides F)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 100% identity to rah:Rahaq_2278)

MetaCyc: 62% identical to outer membrane lipoprotein LolB (Escherichia coli K-12 substr. MG1655)
RXN-22553

Predicted SEED Role

"Outer membrane lipoprotein LolB precursor"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>EX31_RS07325 lipoprotein localization protein LolB (Rahnella sp. WP5)
MPMRKAHFVRLLPLASLVLAACSINAPKGPATSPTSPQWREHEAQVKQLEHYQTRGSFAY
LSDKQKVYARFFWQQYSPDSYRLLLTNPLGSTEMELKVQSGIAQLTNNEGKHYTSDNPDD
MIQKLTGMSIPLANLRLWMLGLPGDGTDFTLDSQYRLSQVKFTQNGKPGTVVYQSYDEDA
KPSLPQRLEMTQGEQRIKLKMDNWTLN