Protein Info for EX31_RS07290 in Rahnella sp. WP5

Annotation: C4-dicarboxylic acid transporter DauA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 172 to 199 (28 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 356 to 387 (32 residues), see Phobius details amino acids 407 to 437 (31 residues), see Phobius details TIGR00815: sulfate permease" amino acids 19 to 554 (536 residues), 437.2 bits, see alignment E=4.3e-135 PF00916: Sulfate_transp" amino acids 29 to 411 (383 residues), 262.5 bits, see alignment E=5.7e-82 PF01740: STAS" amino acids 451 to 554 (104 residues), 49 bits, see alignment E=4.8e-17

Best Hits

Swiss-Prot: 73% identical to DAUA_ECO57: C4-dicarboxylic acid transporter DauA (dauA) from Escherichia coli O157:H7

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to rah:Rahaq_2271)

MetaCyc: 73% identical to aerobic C4-dicarboxylate transporter DauA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-122A; TRANS-RXN0-553

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>EX31_RS07290 C4-dicarboxylic acid transporter DauA (Rahnella sp. WP5)
MNTSGRRHIRPFSALIDACFREKYTLQRLLKDAIAGVTVGIIAIPLAMALAIGSGVPPQY
GLYTSAIAGIVIAVFGGSRFSVSGPTAAFVVILYPVSQQFGLSGLLLATLMSGFMLLFMG
LARFGRLIEYIPLPVTLGFTSGIAITIGTMQFKDFFGLTMATVPEHYLSKVAALVMALPT
LDIGDAAIGIVTLGILILWPKLGLRVPGHLPALLAGCAVMAIFMQAGHPVATIGSRFHFL
LPDGSQGNGIPPILPQFALPWTQSDGSGLSWSLVQALLPAAFSMAMLGAIESLLCAVVLD
GMTGKKHHSDNELIGQGIGNMVSPFFGGITATAAIARSAANVRAGATSPVSAIIHSLLVI
LALLILAPLLSWLPLAAMAALLLMVAWNMSEAHKVVDLLRRAPKDDILVMLTCMSLTVLF
DMVIAITAGIVMASLLFMRRIAKLTRLTEVMADIPEDTLVLRINGPLFFAAAERIFSELQ
VRSEGKKVIILVWDRVAVLDAGGVSALRNFINTLPEGTELRIAEIPFQPLKTLARARMQP
VEGKLSFHSSLHDAL