Protein Info for EX31_RS07260 in Rahnella sp. WP5

Annotation: formate-dependent uric acid utilization protein AegA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 54 to 147 (94 residues), 29.1 bits, E=6.7e-10
• PF12837: Fer4_6
  • amino acids 83 to 101 (19 residues), 24.4 bits, see alignment (E = 1.5e-08)
• PF00037: Fer4
  • amino acids 83 to 102 (20 residues), 30.7 bits, see alignment (E = 1.3e-10)
• PF12838: Fer4_7
  • amino acids 85 to 144 (60 residues), 29 bits, 8.4e-10
• PF13187: Fer4_9
  • amino acids 85 to 144 (60 residues), 27.2 bits, 2.3e-09
• TIGR01318: glutamate synthase, small subunit
  • amino acids 187 to 648 (462 residues), 762.7 bits, E=6e-234
• PF14691: Fer4_20
  • amino acids 202 to 311 (110 residues), 117.2 bits, E=2.3e-37
• PF07992: Pyr_redox_2
  • amino acids 324 to 636 (313 residues), 68.4 bits, E=5.1e-22
• PF01494: FAD_binding_3
  • amino acids 324 to 356 (33 residues), 27 bits, see alignment (E = 1.9e-09)
• PF01946: Thi4
  • amino acids 325 to 391 (67 residues), 27.4 bits, E=1.4e-09
• PF00070: Pyr_redox
  • amino acids 325 to 396 (72 residues), 23.5 bits, E=4.6e-08
• PF13450: NAD_binding_8
  • amino acids 328 to 362 (35 residues), 32.6 bits, see alignment (E = 5.6e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2265)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (659 amino acids)

>EX31_RS07260 formate-dependent uric acid utilization protein AegA (Rahnella sp. WP5)
MNQFIIADSQACIGCRACEVACVLSHNEQCYPSKEQFTPRIHVIRQNDRHSAVLCRQCED
APCLQVCPTNAFVRRNDSIQLLEERCIGCKTCAVACPFGAIDIVQHESYPLTGLPAAAAV
AHKCDLCNDSPDGQACVNACPTQALHLITDQVIAQNRADKQYRAAMGRNPQVSLTSKSAA
VFAAALAPPRLDAAKAPLTERKSTFNEIYARFTPMQVEEQAGRCLHCSDHPFCAWTCPLH
NDIPQLLALAKQGHILEAVELSHRTSSLPEICGRVCPQDRLCEGACTFDKQGSVSIGNIE
RYITDTALAQGWKPDLSEVIPRNYRVAVVGAGPAGLGCADVLARHGVKAVVFDRHPEIGG
LLTFGIPAFKLDKNVLVRRREIFTEMGIEFRLNTEIGVDIQAEQLLEEFDAIFLGVGTYK
AMKAGLENENAPGVYSALPFLIANAKHLMNLPELKHEPYVSMAGKRVVVLGGGDTAMDCL
RTSLRQNAKSVICAYRRDEKSMPGSKKKVKNSREEGAEFMFNVQPVSIELNNRNEVCGIR
LVRTAPGEPDASGRRRPTPIAGSEFLLEAEAVIMAFGFLPHAMPWLDELSVRHDEQGLLQ
APHHSRFPYQTSHPQIFAGGDAVRGADLVVTAMSDGRQAANSIIASLDFRTPALRPAAH