Protein Info for EX31_RS07235 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 11 to 79 (69 residues), 49.4 bits, see alignment E=5e-17 PF00528: BPD_transp_1" amino acids 116 to 337 (222 residues), 136.2 bits, see alignment E=1.1e-43

Best Hits

Swiss-Prot: 42% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to rah:Rahaq_2260)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>EX31_RS07235 ABC transporter permease (Rahnella sp. WP5)
MSKRLKGFLSTCISVCLTLFGLSVVTFFIGRVMPTDPVLAAVGDNAPQAVVERVRHEMGL
DQPLWLQFFHYLSQVFHGDLGRSALTSNLVTTDIARFFPATLELATAAIIIAAIVGIPLG
VWAATRQGSWIDQTIRVVCLAGHSLPVFVLALLSLLIFYSALGIAPGPGRQDIIYQDMIP
QVTGLLTVDSLLAGDMGAFWDALAHMVQPVLILAYFSMAYITRMTRTFMLNALGGEYVIT
ARAKGLSAQRVIWKHAFPTVGVQLITVLALTYAGLLEGAVVTENVFSWPGLGQYLTVSLM
NADMNPVIGSTLLIGAIYVLLNLLADLLYRLLDPRVK