Protein Info for EX31_RS07200 in Rahnella sp. WP5

Annotation: FNR family transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00027: cNMP_binding" amino acids 51 to 132 (82 residues), 58.7 bits, see alignment E=6.7e-20 PF13545: HTH_Crp_2" amino acids 168 to 241 (74 residues), 58.7 bits, see alignment E=7e-20 PF00325: Crp" amino acids 193 to 223 (31 residues), 54.7 bits, see alignment 9.9e-19

Best Hits

Swiss-Prot: 94% identical to FNR_KLEOX: Fumarate nitrate reduction regulatory protein (fnr) from Klebsiella oxytoca

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 100% identity to rah:Rahaq_2253)

Predicted SEED Role

"Fumarate and nitrate reduction regulatory protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>EX31_RS07200 FNR family transcription factor (Rahnella sp. WP5)
MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQALFK
AGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGGLQHPSFAQALETSM
VCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRR
FAQRGFSQREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSEMLSVKGKYITIENHEMLS
QLAGQSAPVSA