Protein Info for EX31_RS07160 in Rahnella sp. WP5

Annotation: HTH-type transcriptional regulator Cbl

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00126: HTH_1" amino acids 3 to 63 (61 residues), 47.1 bits, see alignment E=2.9e-16 PF03466: LysR_substrate" amino acids 89 to 292 (204 residues), 149.8 bits, see alignment E=1.1e-47 PF12849: PBP_like_2" amino acids 91 to 179 (89 residues), 27.3 bits, see alignment E=4.5e-10

Best Hits

Swiss-Prot: 69% identical to CBL_ECOLI: HTH-type transcriptional regulator cbl (cbl) from Escherichia coli (strain K12)

KEGG orthology group: K13635, LysR family transcriptional regulator, cys regulon transcriptional activator (inferred from 100% identity to rah:Rahaq_2245)

MetaCyc: 42% identical to DNA-binding transcriptional dual regulator CysB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Alkanesulfonate utilization operon LysR-family regulator CbI" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>EX31_RS07160 HTH-type transcriptional regulator Cbl (Rahnella sp. WP5)
MNFQQLKIIRESARCNYNLTEVSNMLFTSQSGVSRHIRELEDELGVEIFIRRGKRLLGLT
EPGKELLAVAERILNEAQNIRRLADVFSKEDAGVLTIATTHTQARYSLPKVIKAFRAIYP
GVRLELHQGSPQEVLTMLLSGQADVAIASEKLMNDPSVAAFPYYRWHHAIVVPQGHPLTL
QHPLTLQHLSEQPLITYRQGITGRSRLDEAFSRAALTADIVLSAQDSDVIKTYVELGLGV
GILADKAFEAARDTGLQLINAEHLFEANTVWLGLKKAQLQRNYVWRFIELCNPGLSVNEI
KEKVFATGGEPVIDYQI