Protein Info for EX31_RS07025 in Rahnella sp. WP5

Annotation: xanthine dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 2 to 453 (452 residues), 609.4 bits, E=2e-187
• PF00111: Fer2
  • amino acids 7 to 70 (64 residues), 32 bits, E=1.9e-11
• PF01799: Fer2_2
  • amino acids 80 to 153 (74 residues), 97.1 bits, E=1e-31
• PF00941: FAD_binding_5
  • amino acids 183 to 344 (162 residues), 175.9 bits, E=1.3e-55
• PF03450: CO_deh_flav_C
  • amino acids 354 to 453 (100 residues), 109.2 bits, E=2e-35

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 100% identity to rah:Rahaq_2217)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• superpathway of purines degradation in plants (15/18 steps found)
• ureide biosynthesis (7/7 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Protein Sequence (467 amino acids)

>EX31_RS07025 xanthine dehydrogenase small subunit (Rahnella sp. WP5)
MIQFLMNGRIHTENLPADTTVLQYLRRDAGRCGTKEGCASGDCGACTVVLAEKQGEQLQY
RTVNACLTFMPAVHGKQLITVEDLKHRGELHHVQQAMVDNHASQCGFCTPGFVMSLFAME
KNKPVFTVEGVQDTLSGNLCRCTGYRPIMDAAKAICEAPQADQFDADARQTLEKLAAISA
TEQPVTIDELAGRYLACPDSRLVAGGTDLALEVTQRYQRLPKLISLSHIPELKAITLTGQ
AIHIGAAAPLSACMPFLHEEFPAFGELLERFASQQIRNQGTFGGNIANASPIGDGGPVLL
ALGASLLLRRGAEQRELPLDQFFLGYRKTALQPGEFIEQIRIPRNTPAARQLRVYKVSKR
LEDDISAVCAALHIEVLNGVVVHARVAFGGMAEVAKRASGCEAQLLGQPWQTATVERACQ
ALELDFTPISDFRASREYRMQVAKNLLRRCHIEMTSPETLMRVTHYV