Protein Info for EX31_RS06895 in Rahnella sp. WP5

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 50 to 95 (46 residues), 41.3 bits, see alignment 1.5e-14 PF16576: HlyD_D23" amino acids 162 to 292 (131 residues), 56.6 bits, see alignment E=3.4e-19 PF13437: HlyD_3" amino acids 216 to 334 (119 residues), 52.7 bits, see alignment E=9.6e-18

Best Hits

KEGG orthology group: None (inferred from 52% identity to oan:Oant_3393)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>EX31_RS06895 HlyD family secretion protein (Rahnella sp. WP5)
MKNIFRYPSIIVVLFLGIIGVMIVLYSWQLFPFNSQVESTDNAYIRGNVTLLSPQVSGYI
TDVKVQDFMPVKKGDVLFVIDNSTYLQELLQAEAAAAQAQVTLQNFEQNRASGAASLQLA
EAELQSAQAAQSKAALDTGRNGPLLEKGLVSKTTGDELHAALLTAQANVAKAHASVNIAR
QDLALVDANKASLAAALKAAQAKVEVAQINLQHTQIVAPSDGQLGEVSARLGQYVSAGTQ
LTSVTPKQVWVTANFKERQLAGIVIGTPATFTVDALNDHPFKGHVVRISPAAGSEFSVLK
ADNATGNFTKISQRIAVRIELEPGQQQSNRLRPGMSTMVSVDTAQAPVSQQY