Protein Info for EX31_RS06800 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 259 (167 residues), 81.7 bits, see alignment E=2.8e-27

Best Hits

Swiss-Prot: 30% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to rah:Rahaq_2172)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>EX31_RS06800 ABC transporter permease (Rahnella sp. WP5)
MSSRRKPLNLMVIGRLPSRKVFVGIAVTLFVILFLAWGLATRSGAIPPIFLPKLTDVWLK
MVSLAQDGTLWSDIKSSLYRISIAFAISSVMSIVIGVLAGCYGFFKALTEPLVDFIRYMP
VVAFVPLTILWTGTDDVQKFLIIWIGTFFQQVLMVIDAVKRVPGDFVGLGRTLGMPDRKI
LFRIVLPGALPGIWDALRISLGWAWTWLVLAELVASTSGLGYRIVVSQRFFQTDTIIGYI
LLLGILGLISDQIMRALERVLFRYNKRRA