Protein Info for EX31_RS06745 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 49 to 73 (25 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 287 (170 residues), 95.9 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to rah:Rahaq_2161)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>EX31_RS06745 ABC transporter permease (Rahnella sp. WP5)
MNSPVSQTAEQHMTSQSALREPAPLPASKKVWHNPMMVPLRPVASRRRWFLGFCFFVLFF
AVWALVTFTGLVSPTFLASPASMLQEGILLFTDFDFTTDIGMTVMRVLGGFILACAIAVP
LGILMGSYKLIEAFFEPFVSFCRYLPASAFVPLLILWAGIGEMQKVLVIFIGSFFQITLM
VAVTVGAARRDLVEAAYTLGATNQSVVRRVIIPGAAPEIAELLRLVLGWAWTYVIVAELI
GSSSGIGHMIVNSQALLNTGQMIFGIIVIGCIGLLSDLLFKAANRRLFVWSSL