Protein Info for EX31_RS06665 in Rahnella sp. WP5

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF03786: UxuA" amino acids 1 to 388 (388 residues), 466.6 bits, see alignment E=4.3e-144 TIGR00695: mannonate dehydratase" amino acids 1 to 393 (393 residues), 657.3 bits, see alignment E=4.5e-202

Best Hits

Swiss-Prot: 79% identical to UXUA_YERE8: Mannonate dehydratase (uxuA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 100% identity to rah:Rahaq_2145)

MetaCyc: 72% identical to D-mannonate dehydratase (Escherichia coli K-12 substr. MG1655)
Mannonate dehydratase. [EC: 4.2.1.8]

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>EX31_RS06665 mannonate dehydratase (Rahnella sp. WP5)
MEQTWRWYGPNDPVSLDDVRQAGATGVVTALHHIPNGEVWPVEEIKKRKAIIEAKGLVWS
VVESIPVHEEIKTRSGDVEKHIANYQQSIRNLAECGIYTVCYNFMPVLDWTRTDLGYLLP
DGSRALRFDHIAFAAFELHLLKREGATSYYSADEQKQAAEYFAAMTQAEKDQLVSNIIAG
LPGAEEGYTLDQFRARLATYDGIDKAKLRENMAHFLRSIVPVAEQCGLSLAVHPDDPPRP
ILGLPRIISTIEDMQWLKETVDSIHNGFCFCTGSYGVREDNDLVKMMTTYADRVHFIHLR
ATQREDVPESFHEADHLDGDVDMVAVIKAILTEEQTRRRAGNLRAIPMRPDHGHQMLDDL
HKKTNPGYSAIGRLRGLAELRGVERALKQSFFSE